SCOPe 2.07: Domain d5c5bd1: 5c5b D:5-273

Lineage for d5c5bd1 (5c5b D:5-273)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.0: automated matches [191660] (1 protein)
   not a true family

6. Protein automated matches [191240] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189695] (6 PDB entries)

8. Domain d5c5bd1: 5c5b D:5-273 [318707]
   Other proteins in same PDB: d5c5ba1, d5c5ba2, d5c5ba3, d5c5bb2, d5c5bc1, d5c5bc2, d5c5bc3, d5c5bd2
   automated match to d2z0oa1
   complexed with gol

Details for d5c5bd1

PDB Entry: 5c5b, 2.9 Å

PDB Description: crystal structure of human appl bar-ph heterodimer

PDB Compounds: (D:) DCC-interacting protein 13-beta

SCOPe Domain Sequences for d5c5bd1:

Sequence; same for both SEQRES and ATOM records:

>d5c5bd1 a.238.1.0 (D:5-273) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkllleealqdspqtrsllsvfeedagtltdytnqllqamqrvygaqnemclatqqlskq
llayekqnfalgkgdeevistlhyfskvvdelnllhtelakqladtmvlpiiqfrekdlt
evstlkdlfglasnehdlsmakysrlpkkkenekvktevgkevaaarrkqhlsslqyyca
lnalqyrkqmammepmigfahgqinffkkgaemfskrmdsflssvadmvqsiqveleaea
ekmrvsqqellsvdesvytpdsdvaapqi

Timeline for d5c5bd1:

• d5c5bd1 first appeared in SCOPe 2.06
  
• d5c5bd1 appears in the current release, SCOPe 2.08