SCOPe 2.07: Domain d5bxlt_: 5bxl T:

Lineage for d5bxlt_ (5bxl T:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d5bxlt_: 5bxl T: [318509]
   Other proteins in same PDB: d5bxla_, d5bxlc_, d5bxld_, d5bxle_, d5bxlg_, d5bxli_, d5bxlj_, d5bxlk_, d5bxll_, d5bxln_, d5bxlo_, d5bxlq_, d5bxlr_, d5bxls_, d5bxlu_, d5bxlw_, d5bxlx_, d5bxly_, d5bxlz_
   automated match to d4g4sg_
   complexed with cl, mg; mutant

Details for d5bxlt_

PDB Entry: 5bxl, 2.8 Å

PDB Description: yeast 20s proteasome beta2-g170a mutant

PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5bxlt_:

Sequence; same for both SEQRES and ATOM records:

>d5bxlt_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

Timeline for d5bxlt_:

• d5bxlt_ first appeared in SCOPe 2.06
  
• d5bxlt_ appears in the current release, SCOPe 2.08