SCOPe 2.07: Domain d5bxle_: 5bxl E:

Lineage for d5bxle_ (5bxl E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)

8. Domain d5bxle_: 5bxl E: [318363]
   Other proteins in same PDB: d5bxla_, d5bxlb_, d5bxlf_, d5bxlg_, d5bxlh_, d5bxli_, d5bxlj_, d5bxlk_, d5bxll_, d5bxlm_, d5bxln_, d5bxlo_, d5bxlp_, d5bxlt_, d5bxlu_, d5bxlv_, d5bxlw_, d5bxlx_, d5bxly_, d5bxlz_
   automated match to d4g4se_
   complexed with cl, mg; mutant

Details for d5bxle_

PDB Entry: 5bxl, 2.8 Å

PDB Description: yeast 20s proteasome beta2-g170a mutant

PDB Compounds: (E:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d5bxle_:

Sequence; same for both SEQRES and ATOM records:

>d5bxle_ d.153.1.0 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

Timeline for d5bxle_:

• d5bxle_ first appeared in SCOPe 2.06
  
• d5bxle_ appears in the current release, SCOPe 2.08