Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein automated matches [190085] (59 species) not a true protein |
Species Daffodil (Narcissus pseudonarcissus) [TaxId:39639] [318114] (2 PDB entries) |
Domain d5ff9a1: 5ff9 A:21-271 [318122] Other proteins in same PDB: d5ff9a2 automated match to d1xq1a_ complexed with aef, nap, so4 |
PDB Entry: 5ff9 (more details), 1.81 Å
SCOPe Domain Sequences for d5ff9a1:
Sequence, based on SEQRES records: (download)
>d5ff9a1 c.2.1.2 (A:21-271) automated matches {Daffodil (Narcissus pseudonarcissus) [TaxId: 39639]} wslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlkydvtgsv cdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavnlesafh lcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewakdnirt nsiapgairtpgtesfvidkdaldrevsrvpfgrigepeevaslaaflcmpsasyitgqv icvdggrting
>d5ff9a1 c.2.1.2 (A:21-271) automated matches {Daffodil (Narcissus pseudonarcissus) [TaxId: 39639]} wslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlkydvtgsv cdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavnlesafh lcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewakdnirt nsiapgairtpgtdrevsrvpfgrigepeevaslaaflcmpsasyitgqvicvdggrtin g
Timeline for d5ff9a1: