Lineage for d5ff9a1 (5ff9 A:21-271)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2843078Species Daffodil (Narcissus pseudonarcissus) [TaxId:39639] [318114] (2 PDB entries)
  8. 2843081Domain d5ff9a1: 5ff9 A:21-271 [318122]
    Other proteins in same PDB: d5ff9a2
    automated match to d1xq1a_
    complexed with aef, nap, so4

Details for d5ff9a1

PDB Entry: 5ff9 (more details), 1.81 Å

PDB Description: noroxomaritidine/norcraugsodine reductase in complex with nadp+ and tyramine
PDB Compounds: (A:) Noroxomaritidine/Norcraugsodine Reductase

SCOPe Domain Sequences for d5ff9a1:

Sequence, based on SEQRES records: (download)

>d5ff9a1 c.2.1.2 (A:21-271) automated matches {Daffodil (Narcissus pseudonarcissus) [TaxId: 39639]}
wslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlkydvtgsv
cdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavnlesafh
lcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewakdnirt
nsiapgairtpgtesfvidkdaldrevsrvpfgrigepeevaslaaflcmpsasyitgqv
icvdggrting

Sequence, based on observed residues (ATOM records): (download)

>d5ff9a1 c.2.1.2 (A:21-271) automated matches {Daffodil (Narcissus pseudonarcissus) [TaxId: 39639]}
wslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlkydvtgsv
cdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavnlesafh
lcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewakdnirt
nsiapgairtpgtdrevsrvpfgrigepeevaslaaflcmpsasyitgqvicvdggrtin
g

SCOPe Domain Coordinates for d5ff9a1:

Click to download the PDB-style file with coordinates for d5ff9a1.
(The format of our PDB-style files is described here.)

Timeline for d5ff9a1: