PDB entry 5ff9

View 5ff9 on RCSB PDB site
Description: Noroxomaritidine/Norcraugsodine Reductase in Complex with NADP+ and tyramine
Class: oxidoreductase
Keywords: short-chain dehydrogenase/reductase alkaloid biosynthesis, OXIDOREDUCTASE
Deposited on 2015-12-18, released 2016-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Noroxomaritidine/Norcraugsodine Reductase
    Species: Narcissus pseudonarcissus [TaxId:39639]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FF9 (Start-256)
    Domains in SCOPe 2.07: d5ff9a_
  • Chain 'B':
    Compound: Noroxomaritidine/Norcraugsodine Reductase
    Species: Narcissus pseudonarcissus [TaxId:39639]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FF9 (0-256)
    Domains in SCOPe 2.07: d5ff9b_
  • Chain 'C':
    Compound: Noroxomaritidine/Norcraugsodine Reductase
    Species: Narcissus pseudonarcissus [TaxId:39639]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FF9
    Domains in SCOPe 2.07: d5ff9c_
  • Chain 'D':
    Compound: Noroxomaritidine/Norcraugsodine Reductase
    Species: Narcissus pseudonarcissus [TaxId:39639]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FF9 (Start-256)
    Domains in SCOPe 2.07: d5ff9d_
  • Heterogens: NAP, SO4, AEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ff9A (A:)
    mslekrwslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlky
    dvtgsvcdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavn
    lesafhlcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewa
    kdnirtnsiapgairtpgtesfvidkdaldrevsrvpfgrigepeevaslaaflcmpsas
    yitgqvicvdggrting
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ff9A (A:)
    slekrwslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlkyd
    vtgsvcdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavnl
    esafhlcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewak
    dnirtnsiapgairtpgtdrevsrvpfgrigepeevaslaaflcmpsasyitgqvicvdg
    grting
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ff9B (B:)
    mslekrwslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlky
    dvtgsvcdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavn
    lesafhlcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewa
    kdnirtnsiapgairtpgtesfvidkdaldrevsrvpfgrigepeevaslaaflcmpsas
    yitgqvicvdggrting
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ff9C (C:)
    mslekrwslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlky
    dvtgsvcdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavn
    lesafhlcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewa
    kdnirtnsiapgairtpgtesfvidkdaldrevsrvpfgrigepeevaslaaflcmpsas
    yitgqvicvdggrting
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ff9C (C:)
    ekrwslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlkydvt
    gsvcdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavnles
    afhlcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewakdn
    irtnsiapgairtpgtesdrevsrvpfgrigepeevaslaaflcmpsasyitgqvicvdg
    grtin
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ff9D (D:)
    mslekrwslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlky
    dvtgsvcdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavn
    lesafhlcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewa
    kdnirtnsiapgairtpgtesfvidkdaldrevsrvpfgrigepeevaslaaflcmpsas
    yitgqvicvdggrting
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ff9D (D:)
    lekrwslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlkydv
    tgsvcdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavnle
    safhlcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewakd
    nirtnsiapgairtpgtesfvidkdaldrevsrvpfgrigepeevaslaaflcmpsasyi
    tgqvicvdggrting