Lineage for d5fbzd1 (5fbz D:21-83)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188855Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 2188856Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 2188857Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. 2188910Protein automated matches [190792] (4 species)
    not a true protein
  7. 2188915Species Hordeum vulgare [TaxId:4513] [317430] (2 PDB entries)
  8. 2188918Domain d5fbzd1: 5fbz D:21-83 [317495]
    Other proteins in same PDB: d5fbza1, d5fbza2, d5fbzc1, d5fbzc2
    automated match to d2ci2i_
    complexed with ca

Details for d5fbzd1

PDB Entry: 5fbz (more details), 1.9 Å

PDB Description: structure of subtilase subhal from bacillus halmapalus - complex with chymotrypsin inhibitor ci2a
PDB Compounds: (D:) subtilisin-chymotrypsin inhibitor-2a

SCOPe Domain Sequences for d5fbzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fbzd1 d.40.1.1 (D:21-83) automated matches {Hordeum vulgare [TaxId: 4513]}
ktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldniaevp
rvg

SCOPe Domain Coordinates for d5fbzd1:

Click to download the PDB-style file with coordinates for d5fbzd1.
(The format of our PDB-style files is described here.)

Timeline for d5fbzd1: