| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) ![]() |
| Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins) automatically mapped to Pfam PF00280 |
| Protein automated matches [190792] (4 species) not a true protein |
| Species Barley (Hordeum vulgare) [TaxId:4513] [317430] (8 PDB entries) |
| Domain d5fbzd1: 5fbz D:21-83 [317495] Other proteins in same PDB: d5fbza1, d5fbza2, d5fbzc1, d5fbzc2 automated match to d2ci2i_ complexed with ca |
PDB Entry: 5fbz (more details), 1.9 Å
SCOPe Domain Sequences for d5fbzd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fbzd1 d.40.1.1 (D:21-83) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
ktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldniaevp
rvg
Timeline for d5fbzd1: