Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (37 species) not a true protein |
Species Bacillus halmapalus [TaxId:79882] [317441] (2 PDB entries) |
Domain d5fbza2: 5fbz A:318-433 [317442] Other proteins in same PDB: d5fbza1, d5fbzb_, d5fbzc1, d5fbzd1 automated match to d1wmda1 complexed with ca |
PDB Entry: 5fbz (more details), 1.9 Å
SCOPe Domain Sequences for d5fbza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fbza2 b.18.1.0 (A:318-433) automated matches {Bacillus halmapalus [TaxId: 79882]} afvnetsplstsqkatysftaqagkplkislvwsdapgsttasltlvndldlvitapngt kyvgndftapydnnwdgrnnvenvfinapqsgtytvevqaynvpvgpqtfslaivh
Timeline for d5fbza2:
View in 3D Domains from other chains: (mouse over for more information) d5fbzb_, d5fbzc1, d5fbzc2, d5fbzd1 |