SCOPe 2.08: Domain d5fbza2: 5fbz A:318-433

Lineage for d5fbza2 (5fbz A:318-433)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Bacillus halmapalus [TaxId:79882] [317441] (2 PDB entries)

8. Domain d5fbza2: 5fbz A:318-433 [317442]
   Other proteins in same PDB: d5fbza1, d5fbzb_, d5fbzc1, d5fbzd1
   automated match to d1wmda1
   complexed with ca

Details for d5fbza2

PDB Entry: 5fbz, 1.9 Å

PDB Description: structure of subtilase subhal from bacillus halmapalus - complex with chymotrypsin inhibitor ci2a

PDB Compounds: (A:) Enzyme subtilase SubHal from Bacillus halmapalus

SCOPe Domain Sequences for d5fbza2:

Sequence; same for both SEQRES and ATOM records:

>d5fbza2 b.18.1.0 (A:318-433) automated matches {Bacillus halmapalus [TaxId: 79882]}
afvnetsplstsqkatysftaqagkplkislvwsdapgsttasltlvndldlvitapngt
kyvgndftapydnnwdgrnnvenvfinapqsgtytvevqaynvpvgpqtfslaivh

Timeline for d5fbza2:

• d5fbza2 first appeared in SCOPe 2.06
  
• d5fbza2 appears in SCOPe 2.07