Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (6 species) not a true protein |
Species Bos taurus [TaxId:9913] [317245] (4 PDB entries) |
Domain d5he3a3: 5he3 A:550-670 [317354] Other proteins in same PDB: d5he3a1, d5he3a2, d5he3b_, d5he3g_ automated match to d3krwa3 complexed with ff1, mg |
PDB Entry: 5he3 (more details), 2.74 Å
SCOPe Domain Sequences for d5he3a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5he3a3 b.55.1.0 (A:550-670) automated matches {Bos taurus [TaxId: 9913]} eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv eetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkpr s
Timeline for d5he3a3: