![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (17 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188447] (653 PDB entries) |
![]() | Domain d5he3a2: 5he3 A:186-549 [317353] Other proteins in same PDB: d5he3a1, d5he3a3, d5he3b_, d5he3g_ automated match to d3v5wa2 complexed with ff1, mg |
PDB Entry: 5he3 (more details), 2.74 Å
SCOPe Domain Sequences for d5he3a2:
Sequence, based on SEQRES records: (download)
>d5he3a2 d.144.1.7 (A:186-549) automated matches {Human (Homo sapiens) [TaxId: 9606]} ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafdi gsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkktknk qlgh
>d5he3a2 d.144.1.7 (A:186-549) automated matches {Human (Homo sapiens) [TaxId: 9606]} ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprtkgiklldsdq elyrnfpltiserwqqevaetvfdtinaetdrlearkktknkqlgh
Timeline for d5he3a2: