Lineage for d5he3a3 (5he3 A:550-670)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803781Species Cow (Bos taurus) [TaxId:9913] [317245] (4 PDB entries)
  8. 2803783Domain d5he3a3: 5he3 A:550-670 [317354]
    Other proteins in same PDB: d5he3a1, d5he3a2, d5he3b_, d5he3g_
    automated match to d3krwa3
    complexed with ff1, mg

Details for d5he3a3

PDB Entry: 5he3 (more details), 2.74 Å

PDB Description: bovine grk2 in complex with gbetagamma subunits and ccg224411
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5he3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5he3a3 b.55.1.0 (A:550-670) automated matches {Cow (Bos taurus) [TaxId: 9913]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkpr
s

SCOPe Domain Coordinates for d5he3a3:

Click to download the PDB-style file with coordinates for d5he3a3.
(The format of our PDB-style files is described here.)

Timeline for d5he3a3: