Lineage for d5he3a1 (5he3 A:30-185)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719790Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2719791Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2719852Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2719853Protein automated matches [190464] (3 species)
    not a true protein
  7. 2719854Species Cow (Bos taurus) [TaxId:9913] [317242] (4 PDB entries)
  8. 2719856Domain d5he3a1: 5he3 A:30-185 [317352]
    Other proteins in same PDB: d5he3a2, d5he3a3, d5he3b_, d5he3g_
    automated match to d3v5wa1
    complexed with ff1, mg

Details for d5he3a1

PDB Entry: 5he3 (more details), 2.74 Å

PDB Description: bovine grk2 in complex with gbetagamma subunits and ccg224411
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5he3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5he3a1 a.91.1.0 (A:30-185) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyeei
kkyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqpy
ieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

SCOPe Domain Coordinates for d5he3a1:

Click to download the PDB-style file with coordinates for d5he3a1.
(The format of our PDB-style files is described here.)

Timeline for d5he3a1: