![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) ![]() long alpha-helix interrupted in the middle automatically mapped to Pfam PF00631 |
![]() | Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins) |
![]() | Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [48673] (72 PDB entries) |
![]() | Domain d5he3g_: 5he3 G: [317386] Other proteins in same PDB: d5he3a1, d5he3a2, d5he3a3, d5he3b_ automated match to d2trcg_ complexed with ff1, mg |
PDB Entry: 5he3 (more details), 2.74 Å
SCOPe Domain Sequences for d5he3g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5he3g_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]} tasiaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfre
Timeline for d5he3g_:
![]() Domains from other chains: (mouse over for more information) d5he3a1, d5he3a2, d5he3a3, d5he3b_ |