SCOPe 2.06: Domain d4rq9a2: 4rq9 A:131-319

Lineage for d4rq9a2 (4rq9 A:131-319)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.0: automated matches [191507] (1 protein)
   not a true family

6. Protein automated matches [190838] (13 species)
   not a true protein

7. Species Stigmatella aurantiaca [TaxId:378806] [317295] (2 PDB entries)

8. Domain d4rq9a2: 4rq9 A:131-319 [317296]
   Other proteins in same PDB: d4rq9a1
   automated match to d2oola1
   complexed with bla, edo, gol, srt; mutant

Details for d4rq9a2

PDB Entry: 4rq9, 2.5 Å

PDB Description: crystal structure of the chromophore-binding domain of stigmatella aurantiaca bacteriophytochrome (thr289his mutant) in the pr state

PDB Compounds: (A:) Photoreceptor-histidine kinase BphP

SCOPe Domain Sequences for d4rq9a2:

Sequence; same for both SEQRES and ATOM records:

>d4rq9a2 d.110.2.0 (A:131-319) automated matches {Stigmatella aurantiaca [TaxId: 378806]}
avpflsffhavrdglsrlrdardlqelceavvqevrgltgfdraiiyrfdaewngsviae
ardaradpylglhfpasdiprqarelyqlnwlriiptidyqparvralpghgepldlsfs
vlrsvspihleylhnmgvqasmsislmkdgklwglischqvsgtryvpyevrtaceflge
vmssllaak

Timeline for d4rq9a2:

• d4rq9a2 is new in SCOPe 2.06-stable
  
• d4rq9a2 appears in SCOPe 2.07
  
• d4rq9a2 appears in the current release, SCOPe 2.08