Lineage for d2oola1 (2ool A:140-333)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
Superfamily d.110.2: GAF domain-like [55781] (5 families) 
alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
Family d.110.2.1: GAF domain [55782] (8 proteins) 
Protein Sensor protein PhyB2 [160655] (1 species) Species Rhodopseudomonas palustris [TaxId:1076] [160656] (1 PDB entry)
Uniprot Q6N5G2 140-333
Domain d2oola1: 2ool A:140-333 [148932]
Other proteins in same PDB: d2oola2, d2oolb2
complexed with lbv
Details for d2oola1
PDB Entry: 2ool (more details), 2.2 Å
PDB Description: crystal structure of the chromophore-binding domain of an unusual bacteriophytochrome rpbphp3 from r. palustris
PDB Compounds: (A:) Sensor proteinSCOPe Domain Sequences for d2oola1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oola1 d.110.2.1 (A:140-333) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]}
rytneffrsvrvairrlqtaadlptacwiaasevrritgfdrikvyqfaadwsgqviaed
rdsgipslldfhfpssdipaqsralytinpvriipdigyrpsplvpdinprlggpidlsf
svlrsvspthleymvnmgmhaamsisivrdnrlwgmischnltprfvsyevrqaceliaq
vltwqigvleeaei
SCOPe Domain Coordinates for d2oola1:
Click to download the PDB-style file with coordinates for d2oola1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2oola1:
- d2oola1 first appeared in SCOP 1.75
- d2oola1 appears in SCOPe 2.05
- d2oola1 appears in SCOPe 2.07
- d2oola1 appears in the current release, SCOPe 2.08
View in 3D
