Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins) Pfam PF08446; PAS_2 |
Protein Sensor protein PhyB2 [160670] (1 species) |
Species Rhodopseudomonas palustris [TaxId:1076] [160671] (1 PDB entry) Uniprot Q6N5G2 26-139 |
Domain d2oolb2: 2ool B:27-138 [148935] Other proteins in same PDB: d2oola1, d2oolb1 automated match to d2oola2 complexed with lbv |
PDB Entry: 2ool (more details), 2.2 Å
SCOPe Domain Sequences for d2oolb2:
Sequence, based on SEQRES records: (download)
>d2oolb2 d.110.3.9 (B:27-138) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} ecdrepihipgaiqphgylfvvsetdlriasvsanvedllrqppasllnvpiahyltaas aarlthalhggdpaainpirldvvtpdgerafngilhrhdsivileleprde
>d2oolb2 d.110.3.9 (B:27-138) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} ecdrepihipgaiqphgylfvvsetdlriasvsanvedllrqppasllnvpiahyltaas aarlthalhgainpirldvvtpdgerafngilhrhdsivileleprde
Timeline for d2oolb2: