Lineage for d2oola2 (2ool A:26-139)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alphaSuperfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) 
alpha-beta(2)-alpha(2)-beta(3)
Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins)
Pfam PF08446; PAS_2
Protein Sensor protein PhyB2 [160670] (1 species) Species Rhodopseudomonas palustris [TaxId:1076] [160671] (1 PDB entry)
Uniprot Q6N5G2 26-139
Domain d2oola2: 2ool A:26-139 [148933]
Other proteins in same PDB: d2oola1, d2oolb1
complexed with lbv
Details for d2oola2
PDB Entry: 2ool (more details), 2.2 Å
PDB Description: crystal structure of the chromophore-binding domain of an unusual bacteriophytochrome rpbphp3 from r. palustris
PDB Compounds: (A:) Sensor proteinSCOPe Domain Sequences for d2oola2:
Sequence, based on SEQRES records: (download)
>d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]}
tecdrepihipgaiqphgylfvvsetdlriasvsanvedllrqppasllnvpiahyltaa
saarlthalhggdpaainpirldvvtpdgerafngilhrhdsivileleprdes
Sequence, based on observed residues (ATOM records): (download)
>d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]}
tecdrepihipgaiqphgylfvvsetdlriasvsanvedllrqppasllnvpiahyltaa
saarlthalhgainpirldvvtpdgerafngilhrhdsivileleprdes
SCOPe Domain Coordinates for d2oola2:
Click to download the PDB-style file with coordinates for d2oola2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2oola2:
- d2oola2 first appeared in SCOP 1.75
- d2oola2 appears in SCOPe 2.05
- d2oola2 appears in SCOPe 2.07
- d2oola2 appears in the current release, SCOPe 2.08
View in 3D
