Lineage for d2oola2 (2ool A:26-139)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970589Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins)
    Pfam PF08446; PAS_2
  6. 2970624Protein Sensor protein PhyB2 [160670] (1 species)
  7. 2970625Species Rhodopseudomonas palustris [TaxId:1076] [160671] (1 PDB entry)
    Uniprot Q6N5G2 26-139
  8. 2970626Domain d2oola2: 2ool A:26-139 [148933]
    Other proteins in same PDB: d2oola1, d2oolb1
    complexed with lbv

Details for d2oola2

PDB Entry: 2ool (more details), 2.2 Å

PDB Description: crystal structure of the chromophore-binding domain of an unusual bacteriophytochrome rpbphp3 from r. palustris
PDB Compounds: (A:) Sensor protein

SCOPe Domain Sequences for d2oola2:

Sequence, based on SEQRES records: (download)

>d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]}
tecdrepihipgaiqphgylfvvsetdlriasvsanvedllrqppasllnvpiahyltaa
saarlthalhggdpaainpirldvvtpdgerafngilhrhdsivileleprdes

Sequence, based on observed residues (ATOM records): (download)

>d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]}
tecdrepihipgaiqphgylfvvsetdlriasvsanvedllrqppasllnvpiahyltaa
saarlthalhgainpirldvvtpdgerafngilhrhdsivileleprdes

SCOPe Domain Coordinates for d2oola2:

Click to download the PDB-style file with coordinates for d2oola2.
(The format of our PDB-style files is described here.)

Timeline for d2oola2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oola1