Lineage for d4rq9a2 (4rq9 A:131-319)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970256Family d.110.2.0: automated matches [191507] (1 protein)
    not a true family
  6. 2970257Protein automated matches [190838] (19 species)
    not a true protein
  7. 2970308Species Stigmatella aurantiaca [TaxId:378806] [317295] (3 PDB entries)
  8. 2970311Domain d4rq9a2: 4rq9 A:131-319 [317296]
    Other proteins in same PDB: d4rq9a1
    automated match to d2oola1
    complexed with bla, edo, gol, srt; mutant

Details for d4rq9a2

PDB Entry: 4rq9 (more details), 2.5 Å

PDB Description: crystal structure of the chromophore-binding domain of stigmatella aurantiaca bacteriophytochrome (thr289his mutant) in the pr state
PDB Compounds: (A:) Photoreceptor-histidine kinase BphP

SCOPe Domain Sequences for d4rq9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rq9a2 d.110.2.0 (A:131-319) automated matches {Stigmatella aurantiaca [TaxId: 378806]}
avpflsffhavrdglsrlrdardlqelceavvqevrgltgfdraiiyrfdaewngsviae
ardaradpylglhfpasdiprqarelyqlnwlriiptidyqparvralpghgepldlsfs
vlrsvspihleylhnmgvqasmsislmkdgklwglischqvsgtryvpyevrtaceflge
vmssllaak

SCOPe Domain Coordinates for d4rq9a2:

Click to download the PDB-style file with coordinates for d4rq9a2.
(The format of our PDB-style files is described here.)

Timeline for d4rq9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rq9a1