SCOPe 2.08: Domain d5c2za1: 5c2z A:32-278

Lineage for d5c2za1 (5c2z A:32-278)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein automated matches [190306] (9 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [316235] (1 PDB entry)

8. Domain d5c2za1: 5c2z A:32-278 [316512]
   Other proteins in same PDB: d5c2za2
   automated match to d5c2zb_

Details for d5c2za1

PDB Entry: 5c2z, 1.96 Å

PDB Description: molecular insights into the specificity of exfoliative toxins from staphylococcus aureus

PDB Compounds: (A:) Exfoliative toxin D2

SCOPe Domain Sequences for d5c2za1:

Sequence; same for both SEQRES and ATOM records:

>d5c2za1 b.47.1.1 (A:32-278) automated matches {Staphylococcus aureus [TaxId: 1280]}
ieytdeeiqkkrdffktrpsdselfskiqdttrspyssvgtvfvkgktiatgiligkntv
itnkhiarlaendpnkviftpgstrdegslvvkkpfgefiaeeineapygggtdlsiikl
kpnqygksagdlvtpaaipdnvdvqkgdkisllgypyntsthslyksqievfnnqtfqyf
aytepgnsgsgifnlhgelvgihsgkggqyglpfgilfnrqigssystdktvttlaidlk
nkaktqe

Timeline for d5c2za1:

• d5c2za1 first appeared in SCOPe 2.06
  
• d5c2za1 appears in SCOPe 2.07