Lineage for d5c2za1 (5c2z A:32-278)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794586Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2794786Protein automated matches [190306] (9 species)
    not a true protein
  7. 2794833Species Staphylococcus aureus [TaxId:1280] [316235] (1 PDB entry)
  8. 2794834Domain d5c2za1: 5c2z A:32-278 [316512]
    Other proteins in same PDB: d5c2za2
    automated match to d5c2zb_

Details for d5c2za1

PDB Entry: 5c2z (more details), 1.96 Å

PDB Description: molecular insights into the specificity of exfoliative toxins from staphylococcus aureus
PDB Compounds: (A:) Exfoliative toxin D2

SCOPe Domain Sequences for d5c2za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c2za1 b.47.1.1 (A:32-278) automated matches {Staphylococcus aureus [TaxId: 1280]}
ieytdeeiqkkrdffktrpsdselfskiqdttrspyssvgtvfvkgktiatgiligkntv
itnkhiarlaendpnkviftpgstrdegslvvkkpfgefiaeeineapygggtdlsiikl
kpnqygksagdlvtpaaipdnvdvqkgdkisllgypyntsthslyksqievfnnqtfqyf
aytepgnsgsgifnlhgelvgihsgkggqyglpfgilfnrqigssystdktvttlaidlk
nkaktqe

SCOPe Domain Coordinates for d5c2za1:

Click to download the PDB-style file with coordinates for d5c2za1.
(The format of our PDB-style files is described here.)

Timeline for d5c2za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5c2za2
View in 3D
Domains from other chains:
(mouse over for more information)
d5c2zb_