Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
Protein automated matches [190306] (9 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [316235] (1 PDB entry) |
Domain d5c2zb_: 5c2z B: [316236] Other proteins in same PDB: d5c2za2 automated match to d1dt2a_ |
PDB Entry: 5c2z (more details), 1.96 Å
SCOPe Domain Sequences for d5c2zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c2zb_ b.47.1.1 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} ieytdeeiqkkrdffktrpsdselfskiqdttrspyssvgtvfvkgktiatgiligkntv itnkhiarlaendpnkviftpgstrdegslvvkkpfgefiaeeineapygggtdlsiikl kpnqygksagdlvtpaaipdnvdvqkgdkisllgypyntsthslyksqievfnnqtfqyf aytepgnsgsgifnlhgelvgihsgkggqyglpfgilfnrqigssystdktvttlaidlk nkaktqeq
Timeline for d5c2zb_: