Lineage for d1b6ra2 (1b6r A:1-78)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1161658Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1161659Superfamily c.30.1: PreATP-grasp domain [52440] (8 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1161660Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 1161791Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain [52446] (1 species)
  7. 1161792Species Escherichia coli [TaxId:562] [52447] (4 PDB entries)
  8. 1161797Domain d1b6ra2: 1b6r A:1-78 [31648]
    Other proteins in same PDB: d1b6ra1, d1b6ra3
    complexed with so4

Details for d1b6ra2

PDB Entry: 1b6r (more details), 2.1 Å

PDB Description: n5-carboxyaminoimidazole ribonucleotide synthetase from e. coli
PDB Compounds: (A:) protein (n5-carboxyaminoimidazole ribonucleotide synthetase)

SCOPe Domain Sequences for d1b6ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6ra2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]}
mkqvcvlgngqlgrmlrqageplgiavwpvgldaepaavpfqqsvitaeierwpetaltr
qlarhpafvnrdvfpiia

SCOPe Domain Coordinates for d1b6ra2:

Click to download the PDB-style file with coordinates for d1b6ra2.
(The format of our PDB-style files is described here.)

Timeline for d1b6ra2: