SCOPe 2.08: Domain d1b6ra2: 1b6r A:1-78

Lineage for d1b6ra2 (1b6r A:1-78)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain [52446] (1 species)

7. Species Escherichia coli [TaxId:562] [52447] (4 PDB entries)

8. Domain d1b6ra2: 1b6r A:1-78 [31648]
   Other proteins in same PDB: d1b6ra1, d1b6ra3
   complexed with so4
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1b6ra2

PDB Entry: 1b6r, 2.1 Å

PDB Description: n5-carboxyaminoimidazole ribonucleotide synthetase from e. coli

PDB Compounds: (A:) protein (n5-carboxyaminoimidazole ribonucleotide synthetase)

SCOPe Domain Sequences for d1b6ra2:

Sequence; same for both SEQRES and ATOM records:

>d1b6ra2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]}
mkqvcvlgngqlgrmlrqageplgiavwpvgldaepaavpfqqsvitaeierwpetaltr
qlarhpafvnrdvfpiia

Timeline for d1b6ra2:

• d1b6ra2 first appeared (with stable ids) in SCOP 1.55
  
• d1b6ra2 appears in SCOPe 2.07