Lineage for d1b6ra2 (1b6r A:1-78)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22644Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 22645Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 22646Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)
  6. 22722Protein N5-carboxyaminoimidazole ribonucleotide synthetase, AIRC, PurK [52446] (1 species)
  7. 22723Species Escherichia coli [TaxId:562] [52447] (2 PDB entries)
  8. 22724Domain d1b6ra2: 1b6r A:1-78 [31648]
    Other proteins in same PDB: d1b6ra1, d1b6ra3

Details for d1b6ra2

PDB Entry: 1b6r (more details), 2.1 Å

PDB Description: n5-carboxyaminoimidazole ribonucleotide synthetase from e. coli

SCOP Domain Sequences for d1b6ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6ra2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase, AIRC, PurK {Escherichia coli}
mkqvcvlgngqlgrmlrqageplgiavwpvgldaepaavpfqqsvitaeierwpetaltr
qlarhpafvnrdvfpiia

SCOP Domain Coordinates for d1b6ra2:

Click to download the PDB-style file with coordinates for d1b6ra2.
(The format of our PDB-style files is described here.)

Timeline for d1b6ra2: