SCOPe 2.04: Domain d1gsoa2: 1gso A:-2-103

Lineage for d1gsoa2 (1gso A:-2-103)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein Glycinamide ribonucleotide synthetase (GAR-syn), N-domain [52444] (2 species)

7. Species Escherichia coli [TaxId:562] [52445] (1 PDB entry)

8. Domain d1gsoa2: 1gso A:-2-103 [31647]
   Other proteins in same PDB: d1gsoa1, d1gsoa3

Details for d1gsoa2

PDB Entry: 1gso, 1.6 Å

PDB Description: glycinamide ribonucleotide synthetase (gar-syn) from e. coli.

PDB Compounds: (A:) protein (glycinamide ribonucleotide synthetase)

SCOPe Domain Sequences for d1gsoa2:

Sequence; same for both SEQRES and ATOM records:

>d1gsoa2 c.30.1.1 (A:-2-103) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Escherichia coli [TaxId: 562]}
efmkvlvignggrehalawkaaqsplvetvfvapgnagtalepalqnvaigvtdipalld
faqnekidltivgpeaplvkgvvdtfraaglkifgptagaaqleg

Timeline for d1gsoa2:

• d1gsoa2 first appeared (with stable ids) in SCOP 1.55
  
• d1gsoa2 appears in SCOPe 2.03
  
• d1gsoa2 appears in SCOPe 2.05
  
• d1gsoa2 appears in the current release, SCOPe 2.08