![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily) |
![]() | Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) ![]() |
![]() | Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins) |
![]() | Protein Glycinamide ribonucleotide synthetase (GAR-syn). [52444] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52445] (1 PDB entry) |
![]() | Domain d1gsoa2: 1gso A:-2-103 [31647] Other proteins in same PDB: d1gsoa1, d1gsoa3 |
PDB Entry: 1gso (more details), 1.6 Å
SCOP Domain Sequences for d1gsoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsoa2 c.30.1.1 (A:-2-103) Glycinamide ribonucleotide synthetase (GAR-syn). {Escherichia coli} efmkvlvignggrehalawkaaqsplvetvfvapgnagtalepalqnvaigvtdipalld faqnekidltivgpeaplvkgvvdtfraaglkifgptagaaqleg
Timeline for d1gsoa2: