![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
![]() | Protein Glycinamide ribonucleotide synthetase (GAR-syn), N-domain [52444] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [52445] (1 PDB entry) |
![]() | Domain d1gsoa2: 1gso A:-2-103 [31647] Other proteins in same PDB: d1gsoa1, d1gsoa3 |
PDB Entry: 1gso (more details), 1.6 Å
SCOPe Domain Sequences for d1gsoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsoa2 c.30.1.1 (A:-2-103) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Escherichia coli [TaxId: 562]} efmkvlvignggrehalawkaaqsplvetvfvapgnagtalepalqnvaigvtdipalld faqnekidltivgpeaplvkgvvdtfraaglkifgptagaaqleg
Timeline for d1gsoa2: