Lineage for d4ufxa1 (4ufx A:27-210)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2209919Species Plasmodium vivax [TaxId:5855] [234134] (12 PDB entries)
  8. 2209932Domain d4ufxa1: 4ufx A:27-210 [316442]
    Other proteins in same PDB: d4ufxa2, d4ufxb2, d4ufxc2
    automated match to d1iica1
    complexed with 80o, cl, dms, mg, nhw, so4

Details for d4ufxa1

PDB Entry: 4ufx (more details), 1.49 Å

PDB Description: plasmodium vivax n-myristoyltransferase in complex with a pyridyl inhibitor (compound 19)
PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d4ufxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ufxa1 d.108.1.0 (A:27-210) automated matches {Plasmodium vivax [TaxId: 5855]}
dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse
iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt
dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv
sdar

SCOPe Domain Coordinates for d4ufxa1:

Click to download the PDB-style file with coordinates for d4ufxa1.
(The format of our PDB-style files is described here.)

Timeline for d4ufxa1: