![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (49 species) not a true protein |
![]() | Species Plasmodium vivax [TaxId:5855] [234134] (20 PDB entries) |
![]() | Domain d4ufxa1: 4ufx A:27-210 [316442] Other proteins in same PDB: d4ufxa2, d4ufxb2, d4ufxc2 automated match to d1iica1 complexed with 80o, cl, dms, mg, nhw, so4 |
PDB Entry: 4ufx (more details), 1.49 Å
SCOPe Domain Sequences for d4ufxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ufxa1 d.108.1.0 (A:27-210) automated matches {Plasmodium vivax [TaxId: 5855]} dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv sdar
Timeline for d4ufxa1: