SCOPe 2.06: Domain d1ilea3: 1ile A:1-197,A:387-641

Lineage for d1ilea3 (1ile A:1-197,A:387-641)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Isoleucyl-tRNA synthetase (IleRS) [52387] (2 species)

7. Species Thermus thermophilus [TaxId:274] [52388] (3 PDB entries)

8. Domain d1ilea3: 1ile A:1-197,A:387-641 [31591]
   Other proteins in same PDB: d1ilea1, d1ilea2
   complexed with zn

Details for d1ilea3

PDB Entry: 1ile, 2.5 Å

PDB Description: isoleucyl-trna synthetase

PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1ilea3:

Sequence; same for both SEQRES and ATOM records:

>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]}
mfkevgepnfpkleeevlafwkrekifqksvenrkggprytvyegpptanglphvghaqa
rsykdlfpryktmrgyyaprragwdthglpvelevekklglkskreieaygierfnqacr
esvftyekeweafteriaywvdledayatleptyiesiwwslknlfdrgllyrdhkvvpy
cprcgtplsshevalgyXphcwrcstplmyyateswfikntlfkdelirnnqeihwvpph
ikegrygewlknlvdwalsrnrywgtplpiwvcqacgkeeaigsfqelkaratkplpepf
dphrpyvdqvelacacggtmrrvpyvidvwydsgampfaslhypfeheevfresfpadfi
aegidqtrgwfnslhqlgvmlfgsiafknvichglildekgqkmskskgnvvdpwdiirk
fgadalrwyiyvsappeadrrfgpnlvretvrd

Timeline for d1ilea3:

• d1ilea3 first appeared (with stable ids) in SCOP 1.55, called d1ile_3
  
• d1ilea3 appears in SCOPe 2.05
  
• d1ilea3 appears in SCOPe 2.07
  
• d1ilea3 appears in the current release, SCOPe 2.08