![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (3 families) ![]() |
![]() | Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (8 proteins) |
![]() | Protein Isoleucyl-tRNA synthetase (IleRS) [52387] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [52388] (1 PDB entry) |
![]() | Domain d1ile_3: 1ile 1-197,387-641 [31591] Other proteins in same PDB: d1ile_1, d1ile_2 |
PDB Entry: 1ile (more details), 2.5 Å
SCOP Domain Sequences for d1ile_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ile_3 c.26.1.1 (1-197,387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus} mfkevgepnfpkleeevlafwkrekifqksvenrkggprytvyegpptanglphvghaqa rsykdlfpryktmrgyyaprragwdthglpvelevekklglkskreieaygierfnqacr esvftyekeweafteriaywvdledayatleptyiesiwwslknlfdrgllyrdhkvvpy cprcgtplsshevalgyXphcwrcstplmyyateswfikntlfkdelirnnqeihwvpph ikegrygewlknlvdwalsrnrywgtplpiwvcqacgkeeaigsfqelkaratkplpepf dphrpyvdqvelacacggtmrrvpyvidvwydsgampfaslhypfeheevfresfpadfi aegidqtrgwfnslhqlgvmlfgsiafknvichglildekgqkmskskgnvvdpwdiirk fgadalrwyiyvsappeadrrfgpnlvretvrd
Timeline for d1ile_3: