SCOPe 2.06: Domain d1ilea1: 1ile A:642-821

Lineage for d1ilea1 (1ile A:642-821)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)

6. Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species)

7. Species Thermus thermophilus [TaxId:274] [47329] (3 PDB entries)

8. Domain d1ilea1: 1ile A:642-821 [16924]
   Other proteins in same PDB: d1ilea2, d1ilea3
   complexed with zn

Details for d1ilea1

PDB Entry: 1ile, 2.5 Å

PDB Description: isoleucyl-trna synthetase

PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1ilea1:

Sequence; same for both SEQRES and ATOM records:

>d1ilea1 a.27.1.1 (A:642-821) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]}
yfltlwnvysffvtyanldrpdlknppppekrpemdrwllarmqdliqrvtealeaydpt
tsaralrdfvvedlsqwyvrrnrrrfwknedaldreaayatlyealvlvatlaapftpfl
aevlwqnlvrsvrleakesvhladwpeadpaladealvaqmravlkvvdlaraaraksgv

Timeline for d1ilea1:

• d1ilea1 first appeared (with stable ids) in SCOP 1.55, called d1ile_1
  
• d1ilea1 appears in SCOPe 2.05
  
• d1ilea1 appears in SCOPe 2.07
  
• d1ilea1 appears in the current release, SCOPe 2.08