![]() | Class a: All alpha proteins [46456] (138 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) ![]() |
![]() | Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (4 proteins) |
![]() | Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [47329] (1 PDB entry) |
![]() | Domain d1ile_1: 1ile 642-821 [16924] Other proteins in same PDB: d1ile_2, d1ile_3 |
PDB Entry: 1ile (more details), 2.5 Å
SCOP Domain Sequences for d1ile_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ile_1 a.27.1.1 (642-821) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus} yfltlwnvysffvtyanldrpdlknppppekrpemdrwllarmqdliqrvtealeaydpt tsaralrdfvvedlsqwyvrrnrrrfwknedaldreaayatlyealvlvatlaapftpfl aevlwqnlvrsvrleakesvhladwpeadpaladealvaqmravlkvvdlaraaraksgv
Timeline for d1ile_1: