Lineage for d1ile_1 (1ile 642-821)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2808Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
  4. 2809Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) (S)
  5. 2810Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (4 proteins)
  6. 2814Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species)
  7. 2819Species Thermus thermophilus [TaxId:274] [47329] (1 PDB entry)
  8. 2820Domain d1ile_1: 1ile 642-821 [16924]
    Other proteins in same PDB: d1ile_2, d1ile_3

Details for d1ile_1

PDB Entry: 1ile (more details), 2.5 Å

PDB Description: isoleucyl-trna synthetase

SCOP Domain Sequences for d1ile_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ile_1 a.27.1.1 (642-821) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus}
yfltlwnvysffvtyanldrpdlknppppekrpemdrwllarmqdliqrvtealeaydpt
tsaralrdfvvedlsqwyvrrnrrrfwknedaldreaayatlyealvlvatlaapftpfl
aevlwqnlvrsvrleakesvhladwpeadpaladealvaqmravlkvvdlaraaraksgv

SCOP Domain Coordinates for d1ile_1:

Click to download the PDB-style file with coordinates for d1ile_1.
(The format of our PDB-style files is described here.)

Timeline for d1ile_1: