Lineage for d5g0rf_ (5g0r F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561884Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2561885Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins)
    automatically mapped to Pfam PF02240
  6. 2561886Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 2561887Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (14 PDB entries)
  8. 2561897Domain d5g0rf_: 5g0r F: [315576]
    Other proteins in same PDB: d5g0ra1, d5g0ra2, d5g0rb1, d5g0rb2, d5g0rd1, d5g0rd2, d5g0re1, d5g0re2
    automated match to d3m2vc_
    complexed with cl, f43, k, mg, na, tp7

Details for d5g0rf_

PDB Entry: 5g0r (more details), 1.25 Å

PDB Description: methyl-coenzyme m reductase i from methanothermobacter marburgensis exposed to 3-nitrooxypropanol
PDB Compounds: (F:) Methyl-coenzyme M reductase I subunit gamma

SCOPe Domain Sequences for d5g0rf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g0rf_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnle

SCOPe Domain Coordinates for d5g0rf_:

Click to download the PDB-style file with coordinates for d5g0rf_.
(The format of our PDB-style files is described here.)

Timeline for d5g0rf_: