Lineage for d5g0re2 (5g0r E:189-443)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332765Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2332766Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2332767Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
    C-terminal domain is all-alpha
  6. 2332828Protein automated matches [315354] (3 species)
    not a true protein
  7. 2332829Species Methanothermobacter marburgensis [TaxId:145263] [315355] (2 PDB entries)
  8. 2332837Domain d5g0re2: 5g0r E:189-443 [315356]
    Other proteins in same PDB: d5g0ra1, d5g0rb1, d5g0rc_, d5g0rd1, d5g0re1, d5g0rf_
    automated match to d1hbnb1
    complexed with cl, f43, k, mg, na, tp7

Details for d5g0re2

PDB Entry: 5g0r (more details), 1.25 Å

PDB Description: methyl-coenzyme m reductase i from methanothermobacter marburgensis exposed to 3-nitrooxypropanol
PDB Compounds: (E:) Methyl-coenzyme M reductase I subunit beta

SCOPe Domain Sequences for d5g0re2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g0re2 a.89.1.1 (E:189-443) automated matches {Methanothermobacter marburgensis [TaxId: 145263]}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei

SCOPe Domain Coordinates for d5g0re2:

Click to download the PDB-style file with coordinates for d5g0re2.
(The format of our PDB-style files is described here.)

Timeline for d5g0re2: