Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins) automatically mapped to Pfam PF02240 |
Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (14 PDB entries) |
Domain d5g0rc_: 5g0r C: [315381] Other proteins in same PDB: d5g0ra1, d5g0ra2, d5g0rb1, d5g0rb2, d5g0rd1, d5g0rd2, d5g0re1, d5g0re2 automated match to d3m2vc_ complexed with cl, f43, k, mg, na, tp7 |
PDB Entry: 5g0r (more details), 1.25 Å
SCOPe Domain Sequences for d5g0rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g0rc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]} aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr sqggfnle
Timeline for d5g0rc_: