Lineage for d2cnda2 (2cnd A:125-270)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 984627Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 984628Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 984629Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 984705Protein Nitrate reductase [52355] (1 species)
  7. 984706Species Maize (Zea mays) [TaxId:4577] [52356] (3 PDB entries)
  8. 984707Domain d2cnda2: 2cnd A:125-270 [31549]
    Other proteins in same PDB: d2cnda1
    complexed with fad; mutant

Details for d2cnda2

PDB Entry: 2cnd (more details), 2.5 Å

PDB Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain
PDB Compounds: (A:) nadh-dependent nitrate reductase

SCOPe Domain Sequences for d2cnda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cnda2 c.25.1.1 (A:125-270) Nitrate reductase {Maize (Zea mays) [TaxId: 4577]}
gsfvingkqrnarrlamicggsgitpmyqiiqavlrdqpedhtemhlvyanrteddillr
deldrwaaeypdrlkvwyvidqvkrpeegwkysvgfvteavlrehvpeggddtlalacgp
ppmiqfaispnlekmkydmansfvvf

SCOPe Domain Coordinates for d2cnda2:

Click to download the PDB-style file with coordinates for d2cnda2.
(The format of our PDB-style files is described here.)

Timeline for d2cnda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cnda1