Lineage for d2cnd_2 (2cnd 125-270)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) 
Family c.25.1.1: Reductases [52344] (4 proteins) 
Protein Nitrate reductase [52355] (1 species) Species Corn (Zea mays) [TaxId:4577] [52356] (3 PDB entries) 
Domain d2cnd_2: 2cnd 125-270 [31549]
Other proteins in same PDB: d2cnd_1
Details for d2cnd_2
PDB Entry: 2cnd (more details), 2.5 Å
PDB Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain
SCOP Domain Sequences for d2cnd_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cnd_2 c.25.1.1 (125-270) Nitrate reductase {Corn (Zea mays)}
gsfvingkqrnarrlamicggsgitpmyqiiqavlrdqpedhtemhlvyanrteddillr
deldrwaaeypdrlkvwyvidqvkrpeegwkysvgfvteavlrehvpeggddtlalacgp
ppmiqfaispnlekmkydmansfvvf
SCOP Domain Coordinates for d2cnd_2:
Click to download the PDB-style file with coordinates for d2cnd_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cnd_2:
- d2cnd_2 appears in SCOP 1.57
- d2cnd_2 appears in the current release, SCOPe 2.08, called d2cnda2
View in 3D
