SCOPe 2.08: Domain d2cnda2: 2cnd A:125-270

Lineage for d2cnda2 (2cnd A:125-270)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (5 proteins)

6. Protein Nitrate reductase [52355] (1 species)

7. Species Maize (Zea mays) [TaxId:4577] [52356] (3 PDB entries)

8. Domain d2cnda2: 2cnd A:125-270 [31549]
   Other proteins in same PDB: d2cnda1
   complexed with fad; mutant

Details for d2cnda2

PDB Entry: 2cnd, 2.5 Å

PDB Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain

PDB Compounds: (A:) nadh-dependent nitrate reductase

SCOPe Domain Sequences for d2cnda2:

Sequence; same for both SEQRES and ATOM records:

>d2cnda2 c.25.1.1 (A:125-270) Nitrate reductase {Maize (Zea mays) [TaxId: 4577]}
gsfvingkqrnarrlamicggsgitpmyqiiqavlrdqpedhtemhlvyanrteddillr
deldrwaaeypdrlkvwyvidqvkrpeegwkysvgfvteavlrehvpeggddtlalacgp
ppmiqfaispnlekmkydmansfvvf

Timeline for d2cnda2:

• d2cnda2 first appeared (with stable ids) in SCOP 1.55, called d2cnd_2
  
• d2cnda2 appears in SCOPe 2.07