Lineage for d5b18b_ (5b18 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2408657Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2410152Protein automated matches [190433] (12 species)
    not a true protein
  7. 2410196Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (30 PDB entries)
  8. 2410243Domain d5b18b_: 5b18 B: [315265]
    automated match to d3oqda_
    complexed with act, cl

Details for d5b18b_

PDB Entry: 5b18 (more details), 1.8 Å

PDB Description: crystal structure of a darunavir resistant hiv-1 protease
PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d5b18b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b18b_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrpiitikiggqlkeailntgaddtifeemnlpgrwkpkivggvgglvkvreye
qipieicgrkvistvligptpfniigrnvmtqlgctlnf

SCOPe Domain Coordinates for d5b18b_:

Click to download the PDB-style file with coordinates for d5b18b_.
(The format of our PDB-style files is described here.)

Timeline for d5b18b_: