PDB entry 5b18

View 5b18 on RCSB PDB site
Description: Crystal Structure of a Darunavir Resistant HIV-1 Protease
Class: hydrolase
Keywords: HIV-1 protease, drug resistance, darunavir, flap, HYDROLASE
Deposited on 2015-11-30, released 2016-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5B18 (0-98)
    Domains in SCOPe 2.07: d5b18a_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5B18 (0-98)
    Domains in SCOPe 2.07: d5b18b_
  • Chain 'C':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5B18 (0-98)
    Domains in SCOPe 2.07: d5b18c_
  • Chain 'D':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5B18 (0-98)
    Domains in SCOPe 2.07: d5b18d_
  • Heterogens: CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5b18A (A:)
pqitlwqrpiitikiggqlkeailntgaddtifeemnlpgrwkpkivggvgglvkvreye
qipieicgrkvistvligptpfniigrnvmtqlgctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5b18B (B:)
pqitlwqrpiitikiggqlkeailntgaddtifeemnlpgrwkpkivggvgglvkvreye
qipieicgrkvistvligptpfniigrnvmtqlgctlnf

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5b18C (C:)
pqitlwqrpiitikiggqlkeailntgaddtifeemnlpgrwkpkivggvgglvkvreye
qipieicgrkvistvligptpfniigrnvmtqlgctlnf

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5b18D (D:)
pqitlwqrpiitikiggqlkeailntgaddtifeemnlpgrwkpkivggvgglvkvreye
qipieicgrkvistvligptpfniigrnvmtqlgctlnf