SCOPe 2.07: Domain d5hola1: 5hol A:1-166

Lineage for d5hola1 (5hol A:1-166)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.0: automated matches [191326] (1 protein)
   not a true family

6. Protein automated matches [190146] (12 species)
   not a true protein

7. Species Middle east respiratory syndrome coronavirus [TaxId:1335626] [280335] (3 PDB entries)

8. Domain d5hola1: 5hol A:1-166 [314761]
   Other proteins in same PDB: d5hola2
   automated match to d2fava_
   complexed with apr

Details for d5hola1

PDB Entry: 5hol, 1.59 Å

PDB Description: the crystal structure of the mers-cov macro domain with adp-ribose

PDB Compounds: (A:) ORF1a

SCOPe Domain Sequences for d5hola1:

Sequence; same for both SEQRES and ATOM records:

>d5hola1 c.50.1.0 (A:1-166) automated matches {Middle east respiratory syndrome coronavirus [TaxId: 1335626]}
dplsnfehkvitecvtivlgdaiqvakcygesvlvnaanthlkhgggiagainaaskgav
qkesdeyilakgplqvgdsvllqghslaknilhvvgpdarakqdvsllskcykamnaypl
vvtplvsagifgvkpavsfdylireaktrvlvvvnsqdvyksltiv

Timeline for d5hola1:

• d5hola1 first appeared in SCOPe 2.06
  
• d5hola1 appears in the current release, SCOPe 2.08