PDB entry 5hol

View 5hol on RCSB PDB site
Description: The crystal structure of the MERS-CoV macro domain with ADP-ribose
Class: viral protein
Keywords: complex, non-structural protein, macrodomain, viral protein
Deposited on 2016-01-19, released 2016-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ORF1a
    Species: Middle East respiratory syndrome coronavirus [TaxId:1335626]
    Database cross-references and differences (RAF-indexed):
    • Uniprot T2BBC3 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d5hola1, d5hola2
  • Heterogens: APR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5holA (A:)
gshmdplsnfehkvitecvtivlgdaiqvakcygesvlvnaanthlkhgggiagainaas
kgavqkesdeyilakgplqvgdsvllqghslaknilhvvgpdarakqdvsllskcykamn
ayplvvtplvsagifgvkpavsfdylireaktrvlvvvnsqdvyksltivd

    Sequence, based on observed residues (ATOM records): (download) 
    >5holA (A:)
mdplsnfehkvitecvtivlgdaiqvakcygesvlvnaanthlkhgggiagainaaskga
vqkesdeyilakgplqvgdsvllqghslaknilhvvgpdarakqdvsllskcykamnayp
lvvtplvsagifgvkpavsfdylireaktrvlvvvnsqdvyksltiv