Lineage for d1g2ib_ (1g2i B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177542Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 178184Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) (S)
  5. 178257Family c.23.16.2: Intracellular protease [52325] (1 protein)
  6. 178258Protein Intracellular protease [52326] (1 species)
  7. 178259Species Archaeon Pyrococcus horikoshii [TaxId:53953] [52327] (1 PDB entry)
  8. 178261Domain d1g2ib_: 1g2i B: [31439]

Details for d1g2ib_

PDB Entry: 1g2i (more details), 2 Å

PDB Description: crystal structure of a novel intracellular protease from pyrococcus horikoshii at 2 a resolution

SCOP Domain Sequences for d1g2ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2ib_ c.23.16.2 (B:) Intracellular protease {Archaeon Pyrococcus horikoshii}
mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk

SCOP Domain Coordinates for d1g2ib_:

Click to download the PDB-style file with coordinates for d1g2ib_.
(The format of our PDB-style files is described here.)

Timeline for d1g2ib_: