SCOP 1.61: Domain d1g2ic_: 1g2i C:

Lineage for d1g2ic_ (1g2i C:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families)

5. Family c.23.16.2: Intracellular protease [52325] (1 protein)

6. Protein Intracellular protease [52326] (1 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [52327] (1 PDB entry)

8. Domain d1g2ic_: 1g2i C: [31440]

Details for d1g2ic_

PDB Entry: 1g2i, 2 Å

PDB Description: crystal structure of a novel intracellular protease from pyrococcus horikoshii at 2 a resolution

SCOP Domain Sequences for d1g2ic_:

Sequence; same for both SEQRES and ATOM records:

>d1g2ic_ c.23.16.2 (C:) Intracellular protease {Archaeon Pyrococcus horikoshii}
mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk

Timeline for d1g2ic_:

• d1g2ic_ first appeared (with stable ids) in SCOP 1.55
  
• d1g2ic_ appears in SCOP 1.59
  
• d1g2ic_ appears in SCOP 1.63
  
• d1g2ic_ appears in the current release, SCOPe 2.08