![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
![]() | Protein automated matches [190381] (11 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:127906] [313688] (2 PDB entries) |
![]() | Domain d5eleh_: 5ele H: [313709] automated match to d1jr0d_ complexed with 1pe, a2g, bcn, ca, fuc, gal, nag, ndg |
PDB Entry: 5ele (more details), 1.6 Å
SCOPe Domain Sequences for d5eleh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eleh_ b.40.2.1 (H:) automated matches {Vibrio cholerae [TaxId: 127906]} tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
Timeline for d5eleh_: