PDB entry 5ele

View 5ele on RCSB PDB site
Description: Cholera toxin El Tor B-pentamer in complex with A Lewis-y
Class: toxin
Keywords: Cholera toxin B-pentamer, A Lewis-y, complex, blood group oligosaccharide/antigen, toxin
Deposited on 2015-11-04, released 2016-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae O1 [TaxId:127906]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elea_
  • Chain 'B':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae O1 [TaxId:127906]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eleb_
  • Chain 'C':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae O1 [TaxId:127906]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elec_
  • Chain 'D':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae O1 [TaxId:127906]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eled_
  • Chain 'E':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae O1 [TaxId:127906]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elee_
  • Chain 'F':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae O1 [TaxId:127906]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elef_
  • Chain 'G':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae O1 [TaxId:127906]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eleg_
  • Chain 'H':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae O1 [TaxId:127906]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eleh_
  • Chain 'I':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae O1 [TaxId:127906]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elei_
  • Chain 'J':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae O1 [TaxId:127906]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elej_
  • Heterogens: CA, FUC, BCN, NDG, GAL, A2G, 1PE, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5eleA (A:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5eleB (B:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5eleC (C:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5eleD (D:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5eleE (E:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5eleF (F:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5eleG (G:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5eleH (H:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5eleI (I:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5eleJ (J:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman