Lineage for d5eleh_ (5ele H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2058420Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2058912Protein automated matches [190381] (8 species)
    not a true protein
  7. 2059000Species Vibrio cholerae [TaxId:127906] [313688] (1 PDB entry)
  8. 2059008Domain d5eleh_: 5ele H: [313709]
    automated match to d1jr0d_
    complexed with 1pe, a2g, bcn, ca, fuc, gal, nag, ndg

Details for d5eleh_

PDB Entry: 5ele (more details), 1.6 Å

PDB Description: cholera toxin el tor b-pentamer in complex with a lewis-y
PDB Compounds: (H:) Cholera enterotoxin subunit B

SCOPe Domain Sequences for d5eleh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eleh_ b.40.2.1 (H:) automated matches {Vibrio cholerae [TaxId: 127906]}
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d5eleh_:

Click to download the PDB-style file with coordinates for d5eleh_.
(The format of our PDB-style files is described here.)

Timeline for d5eleh_: