SCOPe 2.08: Domain d5aeka_: 5aek A:

Lineage for d5aeka_ (5aek A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Sentrin-specific protease 2, SENP2 [110771] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110772] (7 PDB entries)
   Uniprot Q9HC62 366-589

8. Domain d5aeka_: 5aek A: [313419]
   Other proteins in same PDB: d5aekb_, d5aekd_, d5aekf_, d5aekh_, d5aekj_, d5aekl_, d5aekn_, d5aekp_, d5aekr_, d5aekt_, d5aekv_, d5aekx_
   automated match to d2io0a1

Details for d5aeka_

PDB Entry: 5aek, 3 Å

PDB Description: crystal structure of the human senp2 c548s in complex with the human sumo1 k48m f66w

PDB Compounds: (A:) Sentrin-specific protease 2

SCOPe Domain Sequences for d5aeka_:

Sequence; same for both SEQRES and ATOM records:

>d5aeka_ d.3.1.7 (A:) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens) [TaxId: 9606]}
eltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllver
nkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvidl
rkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlngs
dsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll

Timeline for d5aeka_:

• d5aeka_ first appeared in SCOPe 2.06
  
• d5aeka_ appears in SCOPe 2.07